Anti-PTRH2 antibody produced in rabbit

NA.41

Bcl-2 inhibitor of transcription/peptidyl-tRNA hydrolase 2 (PTRH2, BIT1, PTH2) is a mitochondrial protein released into the cytoplasm during apoptosis. Bit1 complexes with AES, a small Groucho/transducin-like enhancer of split (TLE) protein, to induce caspase-independent apoptosis. Bit-1 is a mediator of anoikis in cells that lose integrin-mediated cell attachment.

Anti-PTRH2 polyclonal antibody reacts with bovine, human, mouse, rat, canine, chicken, and zebrafish Bcl-2 inhibitor of transcription proteins.

Synthetic peptide directed towards the C terminal region of human PTRH2

Anti-PTRH2 polyclonal antibody is used to tag Bcl-2 inhibitor of transcription for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles Bcl-2 inhibitor of transcription in non-caspase apoptosis and cell anoikis.

The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.

Synthetic peptide located within the following region: RNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRT

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

IgG fraction of antiserum

primary antibodies

polyclonal

buffered aqueous solution

20 kDa

guinea pig, dog, human, horse, bovine

0.5 mg - 1 mg/mL

western blot: suitable

NP_057161

Q9Y3E5

wet ice

?20℃

human ... PTRH2(51651)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3