Anti-POR (AB1) antibody produced in rabbit

NA.41

P450 (cytochrome) oxidoreductase (POR, CγPOR, P450R) is an FAD and FMN microsome membrane-bound enzyme required for electron transfer to several cytochrome P450 enzymes, heme oxygenase(s), cytochrome b(5) and squalene monooxygenases. CγPOR is an essential electron donor to enzymes involved in cholesterol biosynthesis. Mutation of CγPOR have been linked to Antley-Bixler-like Syndrome (ABS).

Anti-POR (AB1) polyclonal antibody reacts with bovine, human, mouse, rat, chicken, zebrafish, pig, canine, and rabbit P450 (cytochrome) oxidoreductases.

Synthetic peptide directed towards the middle region of human POR

Anti-POR (AB1) polyclonal antibody is used to tag P450 (cytochrome) oxidoreductase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of P450 (cytochrome) oxidoreductase in metabolic processes that depend upon electron transfer to P450 enzymes, heme oxygenases, cytochrom b5 and squalene monooxygenases.

POR is an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this POR gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

77 kDa

mouse, rabbit, human, bovine, guinea pig, rat, dog

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_000932

Q63HL4

wet ice

−20℃

human ... POR(5447)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3