Anti-MGME1 antibody produced in rabbit

HPA040913 Human Protein Atlas characterization data

Mitochondrial genome maintenance exonuclease 1 (MGME1) is encoded by the gene mapped to human chromosome 20p11.23. The encoded protein is a member of PD-(D/E) XK nuclease superfamily. MGME1 is a homologue of the bacterial RecB nuclease involved in DNA recombination.

chromosome 20 open reading frame 72 recombinant protein epitope signature tag (PrEST)

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Mitochondrial genome maintenance exonuclease 1 (MGME1) acts as a mitochondrial DNA nuclease and has an ability to cleave DNA with a free end. Loss or mutation in the gene leads to mitochondrial DNA (mtDNA) depletion, deletions, duplications and rearrangements and is also associated with mitochondrial diseases. The encoded protein is also involved in intramolecular recombination of mitochondrial DNA (mtDNA) and in 7S DNA turnover.

Prestige Antibodies ^?are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies ^?to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST83094.

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies ^?Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

NLVQSVLSSRGVAQTPGSVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVL

wet ice

?20℃

human ... C20orf72(92667)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1