Anti-LONP2 antibody produced in rabbit

HPA008862 Human Protein Atlas characterization data

LONP2 (lon peptidase 2) is a peroxisomal matrix protein, which contains a serine protease-like domain and a peroxisome-targeting signal 1 (PTS1) region. It belongs to the ATP-dependent Lon protease family. This protein is composed of 852 amino acids and has a molecular weight of 90kDa.

peroxisomal LON protease-like recombinant protein epitope signature tag (PrEST)

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org)and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

LONP2 (lon peptidase 2) controls the β-oxidation of fatty acids in peroxisomes, in coordination with trypsin domain-containing 1 (Tysnd1). It degrades the self-cleaved C- and N-terminal products of Tysnd1 protein. Thus, it controls the turnover and activity of Tysnd1 enzyme, thereby indirectly controlling peroxisomal fatty acid β-oxidation. In mitochondria, this enzyme is responsible for the degradation of folded protein and promotes non-processive substrate cleavage. This enzyme is thought to play a key role in the synthesis of peroxisomes.

Prestige Antibodies ^?are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies ^?to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST70788.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies ^?Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

TILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVGSNWPKPHYTLLITGLCRFQIVQVLKEKPYPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKYAVQLVEMLDMSVPAVAKLRR

Q86WA8

wet ice

?20℃

human ... LONP2(83752)

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)