Anti-IL6ST antibody produced in rabbit

HPA010558 Human Protein Atlas characterization data

IL6ST (interleukin 6 signal transducer) is produced as a polypeptide with a molecular weight of 130kDa, and its glycosylated to a form of 150kDa weight. It functions a part of receptor signaling complexes for around eight cytokines.

interleukin 6 signal transducer

Anti-IL6ST antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project (www.proteinatlas.org). Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Deletion mutation in IL6ST (interleukin 6 signal transducer) is linked with inflammatory hepatocellular adenoma. Mutations in this gene lead to tumorigenesis, which might be a result of dysfunctional intracellular compartment signaling. Activation of this protein follows ligand-binding, and is succeeded by activation of multiple signaling pathways including, JAK/STAT (Janus kinase/signal transducer and activator of transcription), RAS (rat sarcoma)/RAF/MAPK (mitogen activated kinase), and PI3K (phosphoinositide 3-kinase)/AKT pathways. Circulating levels of soluble IL6ST is linked with the risk of myocardial infarction.

Prestige Antibodies ^?are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies ^?to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Corresponding Antigen APREST71953.

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Prestige Antibodies is a registered trademark of sigma-aldrich Co. LLC

rabbit

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

Prestige Antibodies ^?Powered by Atlas Antibodies

buffered aqueous glycerol solution

human

antibody small pack of 25 μL

immunohistochemistry: 1:50- 1:200

CYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEI

P40189

wet ice

?20℃

human ... IL6ST(3572)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

10 - Combustible liquids

WGK 1

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)