Anti-FICD antibody produced in rabbit

NA.41

Synthetic peptide directed towards the C terminal region of human FICD

Anti-FICD antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

FICD (FIC domain-containing protein) is a 458 amino acid containing single pass membrane protein. FICD facilitates the addition of adenosine 5′-monophosphate (AMP) to specific residues of target proteins. Hence, it mediates the AMP addition to RhoA, Rac and Cdc42 and inactivates the Rho GTPases in vitro. Additionally, FICD arbitrates bacterial pathogenesis as well as eukaryotic posttranslational modification, which may facilitate in regulating key signaling events. In mammalian cells, Fic proteins injected by pathogenic bacteria stimulate the adenylylation of small GTPases that results in collapse of the actin cytoskeleton and cell death.

Synthetic peptide located within the following region: GDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

52 kDa

bovine, mouse, pig, dog, human, horse, rat

0.5 mg - 1 mg/mL

immunohistochemistry: suitable
western blot: suitable

NP_009007

Q9BVA6

wet ice

?20℃

human ... FICD(11153)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3