Anti-ETFB antibody produced in rabbit

NA.41

Synthetic peptide directed towards the C terminal region of human ETFB

Anti-ETFB antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

ETFB (electron-transfer-flavoprotein, β polypeptide) encodes a flavoprotein that belongs to ETF α-subunit/FixB family and is widely expressed in liver, heart and skeletal muscle. It shuttles electrons to the main mitochondrial respiratory chain through ETF-ubiquinone oxidoreductase (ETF dehydrogenase). It plays a crucial role in mechanoregulation of fibroblast cell number in collagen gel culture. Defect in ETFB gene results in Electron transfer flavoprotein (ETF) deficiency that leads to severe metabolic disorder, glutaric acidemia type II (GAII).

Synthetic peptide located within the following region: TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

28 kDa

guinea pig, mouse, human, dog, bovine, rat, horse, yeast, rabbit

0.5 mg - 1 mg/mL

western blot: suitable

NP_001014763

P38117

wet ice

?20℃

human ... ETFB(2109)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3