Anti-ESRRB antibody produced in rabbit

MFCD06798439

NA.41

Synthetic peptide directed towards the N terminal region of human ESRRB

ESRRB encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. Sequence Note: The sequence AF094517.1 is from a chimeric clone. Only the ESRRB sequence was propagated into this RefSeq record. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

rabbit

100

unconjugated

affinity isolated antibody

primary antibodies

polyclonal

buffered aqueous solution

55 kDa

rat, human, guinea pig, horse, bovine, dog

0.5 mg - 1 mg/mL

western blot: suitable

O95718

wet ice

−20℃

human ... ESRRB(2103)

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

12 - Non Combustible Liquids

WGK 3